SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2jngA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2jngA
Domain Number 1 Region: 14-77
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.2e-56
Family CPH domain 0.0000135
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2jngA   PDB: 2jng
Sequence length 105
Comment (A:)
Sequence
gshmrsefasgntyalyvrdtlqpgmrvrmlddyeeisagdegefrqsnngvppvqvfwe
stgrtywvhwhmleilgfeediedmveadeyqgavasrvlgralp
Download sequence
Identical sequences 2jng_A 2jngA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]