SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2jz6A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2jz6A
Domain Number 1 Region: 3-72
Classification Level Classification E-value
Superfamily L28p-like 2.2e-28
Family Ribosomal protein L28 0.000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2jz6A   PDB: 2jz6
Sequence length 77
Comment (A:)
Sequence
qghmimakrcevcgkaprsgntvshsdkkserwfrpnlqkvrvvlpdgtikrmrvctscl
ksgkvkkyvgqvsevgs
Download sequence
Identical sequences 2jz6_A 2jz6A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]