SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2lfbA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2lfbA
Domain Number 1 Region: 4-97
Classification Level Classification E-value
Superfamily Homeodomain-like 9.98e-28
Family Homeodomain 0.00000473
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2lfbA   PDB: 2lfb   SUPERFAMILY: 2lfbA
Sequence length 100
Comment (A:)
Sequence
maridptkkgrrnrfkwgpasqqilfqayerqknpskeeretlveecnraeciqrgvsps
qaqglgsnlvtevrvynwfanrrkeeafrhklamdtykln
Download sequence
Identical sequences 2lfb_A 2lfbA 001530944|e2lfbA1|101.1.1.76|A:1-100 cath|current|2lfbA00/0-99 d2lfba_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]