SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2nn6G from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2nn6G
Domain Number 1 Region: 33-121
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 5.86e-30
Family ECR1 N-terminal domain-like 0.00000242
Further Details:      
 
Domain Number 2 Region: 210-287
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.87e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000732
Further Details:      
 
Domain Number 3 Region: 122-206
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.28e-20
Family Cold shock DNA-binding domain-like 0.00000563
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2nn6G   PDB: 2nn6
Sequence length 289
Comment (G:)
Sequence
mgsshhhhhhsqdpmaepasvaaeslagsraraartvlgqvvlpgeelllpeqedaegpg
gaverplslnaracsrvrvvcgpglrrcgdrllvtkcgrlrhkepgsgsgggvywvdsqq
kryvpvkgdhvigivtaksgdifkvdvggsepaslsylsfegatkrnrpnvqvgdliygq
fvvankdmepemvcidscgrangmgvigqdgllfkvtlglirkllapdceiiqevgklyp
leivfgmngriwvkaktiqqtlilanileacehmtsdqrkqifsrlaes
Download sequence
Identical sequences 2nn6G 2nn6_G

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]