SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2np3A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2np3A
Domain Number 1 Region: 100-210
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 9.84e-29
Family Tetracyclin repressor-like, C-terminal domain 0.000000912
Further Details:      
 
Domain Number 2 Region: 30-83
Classification Level Classification E-value
Superfamily Homeodomain-like 5.77e-19
Family Tetracyclin repressor-like, N-terminal domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2np3A   PDB: 2np3
Sequence length 212
Comment (A:)
Sequence
MTGQAAGPAAGPAAGQATKHAGGRRPGETRTREAILTAARVCFAERGFDATSLRRIAETA
GVDQSLVHHFYGTKENLFLQALELPGKIEEAITAAAQGGLDGIGERVVRAHLSVWDDVSS
RPALMTMVRSAAIHRAAAARLRETATGILARALGGVITGEDAMLRTSMVATQLVGLAMMR
YVAHLEPLASADTDTVARHYGRAVQAIVTDRD
Download sequence
Identical sequences Q9RCV4
gi|21219378|ref|NP_625157.1| 100226.SCO0857 NP_625157.1.49638 2np3_A 2np3_B APC6214 2np3A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]