SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2np5A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2np5A
Domain Number 1 Region: 78-189
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 1.27e-23
Family Tetracyclin repressor-like, C-terminal domain 0.000000893
Further Details:      
 
Domain Number 2 Region: 12-69
Classification Level Classification E-value
Superfamily Homeodomain-like 7.38e-16
Family Tetracyclin repressor-like, N-terminal domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2np5A   PDB: 2np5
Sequence length 203
Comment (A:)
Sequence
MRERRYSSTSPERLAAALFDVAAESGLEGASVREVAKRAGVSIGAVQHHFSTKDEMFAFA
LRTLVDKLLARLSEVERGGDPARALFAAMSQLLPLDEARSREAHVMAAFAVRAATSPSLA
EIRRKTLFTIRTGLSAVLIGIGTPEAETRAALLLATVDGLALDAIGSPALYPPEYLEHAL
DIQIGMILQGADVVPSSSIELAS
Download sequence
Identical sequences Q0S914
WP_011596657.1.53434 WP_011596657.1.78234 2np5A APC6249 gi|111021158|ref|YP_704130.1| 101510.RHA1_ro04179 2np5_A 2np5_B 2np5_C 2np5_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]