SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2o3fA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2o3fA
Domain Number 1 Region: 8-82
Classification Level Classification E-value
Superfamily Homeodomain-like 1.27e-19
Family RpiR-like 0.0000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2o3fA   PDB: 2o3f
Sequence length 111
Comment (A:)
Sequence
snamatgglaiiqsmkhklppserkladyilahphkaiestvneisalanssdaavirlc
kslglkgfqdlkmrvagdlakptfqgyrdivpheplpsisektagnaiqai
Download sequence
Identical sequences 2o3fA 2o3f_A 2o3f_B 2o3f_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]