SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2o7tA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2o7tA
Domain Number 1 Region: 80-188
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 4.3e-23
Family Tetracyclin repressor-like, C-terminal domain 0.000000725
Further Details:      
 
Domain Number 2 Region: 2-76
Classification Level Classification E-value
Superfamily Homeodomain-like 7.36e-17
Family Tetracyclin repressor-like, N-terminal domain 0.0000215
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2o7tA   PDB: 2o7t
Sequence length 199
Comment (A:)
Sequence
gmradalkrrehiitttcnlyrthhhdsltmeniaeqagvgvatlyrnfpdrftldmaca
qylfnvvislqlqaistfptdpegvwtsfnqllfdrglgslvpalapeslddlpdevsal
rrttekntttlinlakqhglvhhdiapgtyivglitisrppitalatisenshkallgly
lsglkhgmmanigehdgks
Download sequence
Identical sequences 2o7t_A 2o7tA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]