SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2oi8A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2oi8A
Domain Number 1 Region: 88-214
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 4.46e-33
Family Tetracyclin repressor-like, C-terminal domain 0.000000181
Further Details:      
 
Domain Number 2 Region: 9-82
Classification Level Classification E-value
Superfamily Homeodomain-like 5.02e-18
Family Tetracyclin repressor-like, N-terminal domain 0.0000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2oi8A   PDB: 2oi8
Sequence length 216
Comment (A:)
Sequence
MPEARTSTPRERYRTQVRAEIKDHAWEQIATAGASALSLNAIAKRMGMSGPALYRYFDGR
DELITELIRDAYRSQADSLRAAAASGADLAGLAHALRAWALDDPQRYFLIFGTPVPGYRA
PDDITEIAAETMAVIVDACAALPPSDGTDGAFDAHLDTHRQWAGDRPAPSSALHRALSFW
SRLHGVLSLELAGQFTGMGFDSALLFEAELKDLLGP
Download sequence
Identical sequences A0A1H2CGD8 D6EIN8 Q9KXS8
NP_628485.1.49638 WP_003974661.1.26049 WP_003974661.1.30910 WP_003974661.1.43399 WP_003974661.1.55229 WP_003974661.1.58943 WP_003974661.1.86682 100226.SCO4313 APC6291 2oi8A gi|21222706|ref|NP_628485.1| 2oi8_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]