SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2omoA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2omoA
Domain Number 1 Region: 23-109
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 1.29e-28
Family PA3566-like 0.0000862
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2omoA   PDB: 2omo
Sequence length 124
Comment (A:)
Sequence
mgsshhhhhhssgrenlyfqghmyvtivyasvktdkteafkeatrmnheqsirepgnmrf
dilqsaddptrfvlyeayktrkdaaahketahyltwrdtvadwmaeprkgviygglyptg
ddgs
Download sequence
Identical sequences 2omoA 2omo_A 2omo_B 2omo_C 2omo_D 2omo_E 2omo_F 2omo_G 2omo_H

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]