SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2oocA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2oocA
Domain Number 1 Region: 11-100
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 1.61e-19
Family SphA-like 0.00000611
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2oocA   PDB: 2ooc
Sequence length 113
Comment (A:)
Sequence
gmarrdisgavdfaylegfaagdfavvdevlalfreqaalwapmldpthpgwkdavhtvk
gaargvgafnlgevcerceagqeslegvrtaldaalldiaayaheqalrslkg
Download sequence
Identical sequences 2ooc_A 2ooc_B 2oocA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]