SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2oodA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2oodA
Domain Number 1 Region: 73-397
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 1.77e-82
Family SAH/MTA deaminase-like 0.0000000000074
Further Details:      
 
Domain Number 2 Region: 372-466
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 2.15e-17
Family SAH/MTA deaminase-like 0.0000266
Further Details:      
 
Domain Number 3 Region: 31-88
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 0.00000000000373
Family SAH/MTA deaminase-like 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2oodA   PDB: 2ood
Sequence length 475
Comment (A:)
Sequence
mslttvgirgtffdfvddpwkhigneqaaarfhqdglmvvtdgvikafgpyekiaaahpg
veithikdriivpgfidghihlpqtrvlgaygeqllpwlqksiypeeikykdrnyaregv
krfldallaagtttcqaftssspvateelfeeasrrnmrviagltgidrnapaefidtpe
nfyrdskrliaqyhdkgrnlyaitprfafgaspellkacqrlkhehpdcwvnthisenpa
ecsgvlvehpdcqdylgvyekfdlvgpkfsgghgvylsnnefrrmskkgaavvfcpcsnl
flgsglfrlgratdpehrvkmsfgtdvgggnrfsmisvlddaykvgmcnntlldgsidps
rkdlaeaernklspyrgfwsvtlggaeglyiddklgnfepgkeadfvaldpnggqlaqpw
hqsliadgagprtvdeaasmlfavmmvgddrcvdetwvmgkrlykkseghhhhhh
Download sequence
Identical sequences 2oodA 2ood_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]