SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2ouxA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2ouxA
Domain Number 1 Region: 138-260
Classification Level Classification E-value
Superfamily CBS-domain pair 5.37e-31
Family CBS-domain pair 0.00000282
Further Details:      
 
Domain Number 2 Region: 8-136
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 1.1e-28
Family MgtE N-terminal domain-like 0.000000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2ouxA   PDB: 2oux
Sequence length 286
Comment (A:)
Sequence
slnegqemeeqfallletlknqqmnefrelflalhiyeqgqfyqsldekdrqhlynylsp
keladmfdvieednenmkdylaemrpsyaadmlaemytdnavdllnmldksqkakylsll
sseeageikellhyedetagaimttefvsivanqtvrsamyvlknqadmaetiyyvyvvd
qenhlvgvislrdlivndddtliadilnervisvhvgddqedvaqtirdydflavpvtdy
ddhllgivtvddiidviddeaasdysglagvdveevsenplkaask
Download sequence
Identical sequences 2ouxA 2oux_A 2oux_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]