SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2ovrA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2ovrA
Domain Number 1 Region: 89-147
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 2.71e-50
Family Skp1 dimerisation domain-like 0.00067
Further Details:      
 
Domain Number 2 Region: 4-63
Classification Level Classification E-value
Superfamily POZ domain 6.66e-39
Family BTB/POZ domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2ovrA   PDB: 2ovr
Sequence length 149
Comment (A:)
Sequence
mpsiklqssdgeifevdveiakqsvtiktmledlgmdpvplpnvnaailkkviqwcthhk
ddpggsgtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpee
irktfnikndfteeeeaqvrkenqwceek
Download sequence
Identical sequences 2ovrA 1fqv_B 1fqv_D 1fqv_F 1fqv_H 1fqv_J 1fqv_L 1fqv_N 1fqv_P 2ovp_A 2ovq_A 2ovr_A cath|current|1fqvB00/2-160 cath|current|1fqvD00/2-160 cath|current|1fqvF00/2-160 cath|current|1fqvH00/2-160 cath|current|1fqvJ00/2-160 cath|current|1fqvL00/2-160 cath|current|1fqvN00/2-160 cath|current|1fqvP00/2-160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]