SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2p70A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2p70A
Domain Number 1 Region: 5-132
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 7.25e-43
Family Insect pheromone/odorant-binding proteins 0.00000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2p70A   PDB: 2p70
Sequence length 132
Comment (A:)
Sequence
sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln
mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka
eihklnwapsmd
Download sequence
Identical sequences 2p70_A 2p71_A 000049458|e2p70A1|108.2.1.10|A:1-132 000049460|e2p71A1|108.2.1.10|A:1-132 cath|current|2p70A00/1-132 cath|current|2p71A00/1-132 d2p70a_ d2p71a_ 2p70A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]