SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2p81A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2p81A
Domain Number 1 Region: 2-40
Classification Level Classification E-value
Superfamily Homeodomain-like 9.63e-20
Family Homeodomain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2p81A   PDB: 2p81
Sequence length 44
Comment (A:)
Sequence
akrefnenrylterrrqqlsselglneaqikiwfqnkrakikks
Download sequence
Identical sequences 2p81A d2p81a_ 2p81_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]