SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2pajA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2pajA
Domain Number 1 Region: 70-403
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 3.38e-88
Family SAH/MTA deaminase-like 0.0000000000127
Further Details:      
 
Domain Number 2 Region: 10-69
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 1.99e-20
Family SAH/MTA deaminase-like 0.0000982
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2pajA   PDB: 2paj
Sequence length 492
Comment (A:)
Sequence
mslttydtqpstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgeti
vdatdcviypawvnthhhlfqsllkgepagldatltpwlaatpyrfralfderrfrlaar
iglielarsgcatvadhnyvyypgmpfdssailfeeaeklglrfvllrggatqtrqlead
lptalrpetldayvadierlaaryhdaspramrrvvmapttvlysispremretaavarr
lglrmhshlsetvgyqdsaysmygkspvafcgehdwlgsdvwyahlvkvdadeiallaqt
gtgvahcpqsngrlgsgicpvremadagvpvsigvdgaasneaadmisevhmtwlaqrar
lgmlaqpayrggsfeggagaasiaevihwgtaggarvmgldevgkvavgyaadiavyrld
dpryfglhdpaigpvasggrpsvmalfsagkrvvvddliegvdikelggearrvvrellr
evvveghhhhhh
Download sequence
Identical sequences 2paj_A 2pajA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]