SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2pd1A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2pd1A
Domain Number 1 Region: 3-100
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 3.68e-27
Family PA3566-like 0.00000475
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2pd1A   PDB: 2pd1
Sequence length 104
Comment (A:)
Sequence
ghmtklalfvrleakpgqeaaladflasalplanaesgttawfalkfgpstfgvfdafad
eagrqahlngqiaaalmanaatllssppniekvellaaklpags
Download sequence
Identical sequences 2pd1_A 2pd1_B 2pd1_C 2pd1_D 2pd1A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]