SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2pg3A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2pg3A
Domain Number 1 Region: 2-215
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 8.4e-69
Family N-type ATP pyrophosphatases 0.00000000228
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2pg3A   PDB: 2pg3
Sequence length 232
Comment (A:)
Sequence
gmkravvvfsggqdsttcliqalqdyddvhcitfdygqrhraeievaqelsqklgaaahk
vldvgllnelatssltrdsipvpdydanaqgipntfvpgrnilfltlasiyayqvgaeav
itgvcetdfsgypdcrdefvkalnqaivlgiardirfetplmwlnkaetwaladyyqqld
tvryhtltcyngikgdgcgqcaachlranglaqyqkdaatvmaslkqkvglr
Download sequence
Identical sequences 2pg3A 2pg3_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]