SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2pkgC from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2pkgC
Domain Number 1 Region: 6-83
Classification Level Classification E-value
Superfamily T-antigen specific domain-like 3.15e-30
Family T-antigen specific domain-like 0.00000267
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2pkgC   PDB: 2pkg
Sequence length 88
Comment (C:)
Sequence
slnpgvdamyckqwpecakkmsancicllcllrmkhenrklyrkdplvwvdcycfdcfrm
wfgldlcegtlllwcdiigqttyrdlkl
Download sequence
Identical sequences 2pkgC 2pkg_C 2pkg_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]