SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2pspA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2pspA
Domain Number 1 Region: 55-102
Classification Level Classification E-value
Superfamily Trefoil 2.78e-16
Family Trefoil 0.0000499
Further Details:      
 
Domain Number 2 Region: 3-51
Classification Level Classification E-value
Superfamily Trefoil 0.00000000000000388
Family Trefoil 0.0000341
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2pspA   PDB: 2psp
Sequence length 106
Comment (A:)
Sequence
ekpaacrcsrqdpknrvncgfpgitsdqcftsgccfdsqvpgvpwcfkplpaqeseecvm
qvsarkncgypgispedcaarnccfsdtipevpwcffpmsvedchy
Download sequence
Identical sequences 1pcp_A 1pos_A 1pos_B 1psp_A 1psp_B 2psp_A 2psp_B 2pspA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]