SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2pstX from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2pstX
Domain Number 1 Region: 7-66
Classification Level Classification E-value
Superfamily MbtH-like 1.54e-44
Family MbtH-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2pstX   PDB: 2pst
Sequence length 74
Comment (X:)
Sequence
ghmtsvfdrddiqfqvvvnheeqysiwpeykeipqgwraagksglkkdclayieevwtdm
rplslrqhmdkaag
Download sequence
Identical sequences 2pstX 2pst_X 5ja2_B cath|current|2pstX00/8-68

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]