SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2puzA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2puzA
Domain Number 1 Region: 78-378
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 4.81e-87
Family Imidazolonepropionase-like 0.0000000000719
Further Details:      
 
Domain Number 2 Region: 16-78,379-417
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 3.89e-34
Family Imidazolonepropionase-like 0.0000907
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2puzA   PDB: 2puz
Sequence length 419
Comment (A:)
Sequence
MPGNNSAKGTATGNATALWRNAQLATLNPAMDGIGAVENAVIAVRNGRIAFAGPESDLPD
DLSTADETTDCGGRWITPALIDCHTHLVFGGNRAMEFEMRLNGATYEEIAKAGGGIVSSV
RDTRALSDEVLVAQALPRLDTLLSEGVSTIEIKSGYGLDIETELKMLRVARRLETLRPVR
IVTSYLAAHATPADYKGRNADYITDVVLPGLEKAHAEGLADAVDGFCEGIAFSVKEIDRV
FAAAQQRGLPVKLHAEQLSNLGGAELAASYNALSADHLEYLDETGAKALAKAGTVAVLLP
GAFYALREKQLPPVQALRDAGAEIALATDCNPGTSPLTSLLLTMNMGATLFRMTVEECLT
ATTRNAAKALGLLAETGTLEAGKSADFAIWDIERPAELVYRIGFNPLHARIFKGQKVSP
Download sequence
Identical sequences A0A083ZMU0 Q8U8Z6
NP_356701.2.86381 WP_010973444.1.51814 WP_010973444.1.57042 2puz_A 2puz_B 176299.Atu3934 gi|159185960|ref|NP_356701.2| NYSGXRC-9252b 2puzA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]