SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2q02A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2q02A
Domain Number 1 Region: 4-270
Classification Level Classification E-value
Superfamily Xylose isomerase-like 4.42e-67
Family IolI-like 0.000000000259
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2q02A   PDB: 2q02
Sequence length 272
Comment (A:)
Sequence
gmniektrfcinrkiapglsieaffrlvkrlefnkvelrndmpsgsvtddlnynqvrnla
ekygleivtinavypfnqlteevvkktegllrdaqgvgaralvlcplndgtivppevtve
aikrlsdlfarydiqglveplgfrvsslrsavwaqqlireagspfkvlldtfhhhlyeea
ekefasridisaiglvhlsgvedtrptealadeqrimlsekdvmqnyqqvqrlenmgyrg
iyafepfssqlaswseaeieeqinrsvslllq
Download sequence
Identical sequences 000321576|e2q02B1|2002.1.1.18|B:1-272 000321578|e2q02D1|2002.1.1.18|D:1-272 2q02A 2q02_A 2q02_B 2q02_C 2q02_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]