SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2q09A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2q09A
Domain Number 1 Region: 66-365
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 1.02e-89
Family Imidazolonepropionase-like 0.0000000000509
Further Details:      
 
Domain Number 2 Region: 5-66,367-405
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 9.26e-29
Family Imidazolonepropionase-like 0.0000526
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2q09A   PDB: 2q09
Sequence length 416
Comment (A:)
Sequence
mslncervwlnvtpatlrsdladygllephalgvhegrihalvpmqdlkgpypahwqdmk
gklvtpglidchthlifagsraeefelrqkgvpyaeiarkgggiistvratraasedqlf
elalprvksliregvttveiksgygltledelkmlrvarrlgealpirvkttllaahavp
peyrddpdswveticqeiipaaaeagladavdvfcehigfslaqteqvylaadqyglavk
ghmdqlsnlggstlaanfgalsvdhleyldpegiqalahrgvvatllptafyflketklp
pvvalrkagvpmavssdinpgtapivslrmamnmactlfgltpveamagvtrhaaralge
qeqlgqlrvgmladflvwncghpaelsyligvdqlvsrvvngeetlhgeghhhhhh
Download sequence
Identical sequences 2oof_A 2q09_A 2q09A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]