SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2q9qA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2q9qA
Domain Number 1 Region: 68-178
Classification Level Classification E-value
Superfamily GINS helical bundle-like 4.98e-37
Family PSF2 C-terminal domain-like 0.000000542
Further Details:      
 
Domain Number 2 Region: 7-66
Classification Level Classification E-value
Superfamily PriA/YqbF domain 9.15e-22
Family PSF2 N-terminal domain-like 0.0000599
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2q9qA   PDB: 2q9q
Sequence length 191
Comment (A:)
Sequence
gplgsnmdaaeveflaekelvtiipnfsldkiyliggdlgpfnpglpvevplwlainlkq
rqkcrllppewmdveklekmrdherkeetftpmpspyymeltklllnhasdnipkadeir
tlvkdmwdtriaklrvsadsfvrqqeahakldnltlmeintsgtfltqalnhmyklrtnl
qplestqsqdf
Download sequence
Identical sequences 2q9q_A 2q9q_E 2q9qA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]