SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2qnhl from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2qnhl
Domain Number 1 Region: 12-127
Classification Level Classification E-value
Superfamily Translational machinery components 6.59e-45
Family Ribosomal protein L18 and S11 0.000000437
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2qnhl   PDB: 2qnh
Sequence length 129
Comment (l:)
Sequence
MAKKPSKKKVKRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYA
AQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCR
PKKKFRKAS
Download sequence
Identical sequences A0A1J1EJL5 F6DEM6 H7GI57 H9ZPM8 P62654 P80376
1fjg_K 1hnw_K 1hnx_K 1hnz_K 1hr0_K 1ibk_K 1ibl_K 1ibm_K 1j5e_K 1jgo_N 1jgp_N 1jgq_N 1ml5_N 1n32_K 1n33_K 1n34_K 1n36_K 1vvj_QK 1vvj_XK 1vy4_AK 1vy4_CK 1vy5_AK 1vy5_CK 1vy6_AK 1vy6_CK 1vy7_AK 1vy7_CK 1xmo_K 1xmq_K 1xnq_K 1xnr_K 2f4v_K 2hhh_K 2uu9_K 2uua_K 2uub_K 2uuc_K 2uxb_K 2uxc_K 2uxd_K 2vqe_K 2vqf_K 3oto_K 3t1h_K 3t1y_K 4aqy_K 4b3m_K 4b3r_K 4b3s_K 4b3t_K 4dr1_K 4dr2_K 4dr3_K 4dr4_K 4dr5_K 4dr6_K 4dr7_K 4duy_K 4duz_K 4dv0_K 4dv1_K 4dv2_K 4dv3_K 4dv4_K 4dv5_K 4dv6_K 4dv7_K 4ji0_K 4ji1_K 4ji2_K 4ji3_K 4ji4_K 4ji5_K 4ji6_K 4ji7_K 4ji8_K 4kvb_K 4l47_QK 4l47_XK 4l71_QK 4l71_XK 4lel_QK 4lel_XK 4lf4_K 4lf5_K 4lf6_K 4lf7_K 4lf8_K 4lf9_K 4lfa_K 4lfb_K 4lfc_K 4lfz_QK 4lfz_XK 4lnt_QK 4lnt_XK 4lsk_QK 4lsk_XK 4lt8_QK 4lt8_XK 4nxm_K 4nxn_K 4ox9_K 4p6f_QK 4p6f_XK 4p70_QK 4p70_XK 4tua_QK 4tua_XK 4tub_QK 4tub_XK 4tuc_QK 4tuc_XK 4tud_QK 4tud_XK 4tue_QK 4tue_XK 4v42_AN 4v4i_l 4v4j_l 4v4p_BN 4v4r_AK 4v4s_AK 4v4t_AK 4v4x_AN 4v4y_AN 4v4z_AN 4v51_AK 4v51_CK 4v5a_AK 4v5a_CK 4v5c_AK 4v5c_CK 4v5d_AK 4v5d_CK 4v5e_AK 4v5e_CK 4v5f_AK 4v5f_CK 4v5g_AK 4v5g_CK 4v5j_AK 4v5j_CK 4v5k_AK 4v5k_CK 4v5l_AK 4v5m_AK 4v5n_AK 4v5p_AK 4v5p_CK 4v5q_AK 4v5q_CK 4v5r_AK 4v5r_CK 4v5s_AK 4v5s_CK 4v63_AK 4v63_CK 4v67_AK 4v67_CK 4v6a_AK 4v6a_CK 4v6f_BN 4v6f_CN 4v6g_AN 4v6g_CN 4v7j_Ak 4v7j_Bk 4v7k_Ak 4v7k_Bk 4v7l_AK 4v7l_CK 4v7m_AK 4v7m_CK 4v7w_AK 4v7w_CK 4v7x_AK 4v7x_CK 4v7y_AK 4v7y_CK 4v7z_AK 4v7z_CK 4v87_BN 4v87_CN 4v8a_CK 4v8a_DK 4v8b_AN 4v8b_CN 4v8c_CN 4v8c_DN 4v8d_AN 4v8d_CN 4v8e_BN 4v8e_DN 4v8f_BN 4v8f_CN 4v8g_AK 4v8g_CK 4v8h_AK 4v8h_CK 4v8i_AK 4v8i_CK 4v8j_AK 4v8j_CK 4v8n_AK 4v8n_CK 4v8o_AK 4v8q_BK 4v8u_AK 4v8u_CK 4v8x_AK 4v8x_CK 4v90_AK 4v95_AK 4v95_CK 4v97_AK 4v97_CK 4v9a_AN 4v9a_CN 4v9b_AN 4v9b_CN 4v9r_AK 4v9r_CK 4v9s_AK 4v9s_CK 4w2e_k 4w2f_AK 4w2f_CK 4w2g_AK 4w2g_CK 4w2h_AK 4w2h_CK 4w2i_AK 4w2i_CK 4w4g_QK 4w4g_XK 4wpo_BK 4wpo_DK 4wq1_2A 4wq1_2I 4wqf_BK 4wqf_DK 4wqr_2A 4wqr_2I 4wqu_BK 4wqu_DK 4wqy_BK 4wqy_DK 4wr6_2A 4wr6_2I 4wra_2A 4wra_2I 4wro_2I 4wsd_2A 4wsd_2I 4wsm_2A 4wsm_2I 4wt1_2A 4wt1_2I 4wu1_2A 4wu1_2I 4wzd_2A 4wzd_2I 4wzo_2A 4wzo_2I 4y4o_1k 4y4o_2k 4y4p_1k 4y4p_2k 4ypb_QK 4ypb_XK 4yy3_K 4yzv_QK 4yzv_XK 4z3s_1k 4z3s_2k 4z8c_1k 4z8c_2k 4zsn_QK 4zsn_XK 5br8_K 5czp_QK 5czp_XK 5d8b_HC 5d8b_LA 5dfe_QK 5dfe_XK 5dox_1k 5dox_2k 5doy_1k 5doy_2k 5e7k_2A 5e7k_2I 5e81_2A 5e81_2I 5el4_2A 5el4_2I 5el5_2A 5el5_2I 5el6_2A 5el6_2I 5el7_2A 5el7_2I 5hau_1k 5hau_2k 5hcp_1k 5hcp_2k 5hcq_1k 5hcq_2k 5hcr_1k 5hcr_2k 5hd1_1k 5hd1_2k 5ib7_2A 5ib7_2I 5ib8_2A 5ib8_2I 5ibb_2A 5ibb_2I 5imq_O 5imr_O 5j30_QK 5j30_XK 5j3c_QK 5j3c_XK 5j4b_1k 5j4b_2k 5j4c_1k 5j4c_2k 5j4d_TA 5j4d_YC 5j8b_k 5lmn_K 5lmo_K 5lmp_K 5lmq_K 5lmr_K 5lms_K 5lmt_K 5lmu_K 5lmv_K 5ndj_2A 5ndj_2I 5ndk_2A 5ndk_2I 5v8i_1k 5v8i_2k 5vp2_1k 5vp2_2k 5vpo_QK 5vpo_XK 5vpp_QK 5vpp_XK 5w4k_1k 5w4k_2k 5wis_1k 5wis_2k 5wit_1k 5wit_2k 5zlu_P 6b4v_TA 6b4v_XC 6boh_UA 6boh_ZC 6bok_SA 6bok_VC 6c5l_AK 6c5l_CK 6cae_1k 6cae_2k 6cfj_1k 6cfj_2k 6cfk_1k 6cfk_2k 6cfl_1k 6cfl_2k 6gsj_2A 6gsj_2I 6gsk_2A 6gsk_2I 6gsl_2A 6gsl_2I 000147542|e3t1hK1|2484.1.1.49|K:1-129 000148827|e3tvfN1|2484.1.1.49|N:1-129 000149053|e4abrK1|2484.1.1.49|K:1-129 000151311|e4aqyK1|2484.1.1.49|K:1-129 cath|current|1fjfK00/11-129 cath|current|1fjgK00/11-129 cath|current|1hnwK00/11-129 cath|current|1hnxK00/11-129 cath|current|1hnzK00/11-129 cath|current|1hr0K00/11-129 cath|current|1ibkK00/11-129 cath|current|1iblK00/11-129 cath|current|1ibmK00/11-129 cath|current|1j5eK00/11-129 cath|current|1n32K00/11-129 cath|current|1n33K00/11-129 cath|current|1n34K00/11-129 cath|current|1n36K00/11-129 cath|current|1vvlK00/11-129 cath|current|1vvnK00/11-129 cath|current|1vvpK00/11-129 cath|current|1vvrK00/11-129 cath|current|1vvtK00/11-129 cath|current|1vvvK00/11-129 cath|current|1vvxK00/11-129 cath|current|1vvzK00/11-129 cath|current|1vx8K00/11-129 cath|current|1vxiK00/11-129 cath|current|1vxkK00/11-129 cath|current|1vxmK00/11-129 cath|current|1vxpK00/11-129 cath|current|1vxsK00/11-129 cath|current|1vy0K00/11-129 cath|current|1vy2K00/11-129 cath|current|1xmoK00/11-129 cath|current|1xmqK00/11-129 cath|current|1xnqK00/11-129 cath|current|1xnrK00/11-129 cath|current|2f4vK00/11-129 cath|current|2hhhK00/11-129 cath|current|2i1cl00/11-126 cath|current|2j00K00/11-129 cath|current|2j02K00/11-129 cath|current|2jl5K00/11-129 cath|current|2jl7K00/11-129 cath|current|2ow8l00/11-126 cath|current|2qnhl00/11-126 cath|current|2uu9K00/11-129 cath|current|2uuaK00/11-129 cath|current|2uubK00/11-129 cath|current|2uucK00/11-129 cath|current|2uxbK00/11-129 cath|current|2uxcK00/11-129 cath|current|2uxdK00/11-129 cath|current|2v46K00/11-129 cath|current|2v48K00/11-129 cath|current|2vqeK00/11-129 cath|current|2vqfK00/11-129 cath|current|2wdgK00/11-129 cath|current|2wdhK00/11-129 cath|current|2wdkK00/11-129 cath|current|2wdmK00/11-129 cath|current|2wh1K00/11-129 cath|current|2wh3K00/11-129 cath|current|2wriK00/11-129 cath|current|2wrkK00/11-129 cath|current|2wrnK00/11-129 cath|current|2wrqK00/11-129 cath|current|2x9rK00/11-129 cath|current|2x9tK00/11-129 cath|current|2xfzK00/11-129 cath|current|2xg1K00/11-129 cath|current|2xqdK00/11-129 cath|current|2y0uK00/11-129 cath|current|2y0wK00/11-129 cath|current|2y0yK00/11-129 cath|current|2y10K00/11-129 cath|current|2y12K00/11-129 cath|current|2y14K00/11-129 cath|current|2y16K00/11-129 cath|current|2y18K00/11-129 cath|current|3d5aK00/11-129 cath|current|3d5cK00/11-129 cath|current|3f1eK00/11-124 cath|current|3f1gK00/11-124 cath|current|3huwK00/11-129 cath|current|3huyK00/11-129 cath|current|3i8gN00/11-129 cath|current|3i8hN00/11-129 cath|current|3i9bN00/9-129 cath|current|3i9dN00/11-129 cath|current|3kiqk00/11-129 cath|current|3kisk00/11-129 cath|current|3kiuk00/11-129 cath|current|3kixk00/11-129 cath|current|3knhK00/11-129 cath|current|3knjK00/11-129 cath|current|3knlK00/11-126 cath|current|3knnK00/11-129 cath|current|3ogeK00/11-129 cath|current|3ogyK00/11-129 cath|current|3ohcK00/11-129 cath|current|3ohdK00/11-129 cath|current|3ohyK00/11-129 cath|current|3oi0K00/11-129 cath|current|3oi2K00/11-129 cath|current|3oi4K00/11-129 cath|current|3otoK00/11-129 cath|current|3t1hK00/11-129 cath|current|3t1yK00/11-129 cath|current|3tvfN00/11-129 cath|current|3tvgN00/11-129 cath|current|3uxsK00/13-126 cath|current|3uxtK00/13-126 cath|current|3uydN00/11-129 cath|current|3uyfN00/11-129 cath|current|3uz3N00/11-129 cath|current|3uz4N00/11-129 cath|current|3uz6N00/11-129 cath|current|3uz7N00/11-129 cath|current|3uzgN00/11-129 cath|current|3uziN00/11-129 cath|current|3uzlN00/11-129 cath|current|3uzmN00/11-129 cath|current|3v22K00/13-126 cath|current|3v24K00/13-126 cath|current|3v26K00/13-126 cath|current|3v28K00/13-126 cath|current|3v2cK00/13-126 cath|current|3v2eK00/13-126 cath|current|3v6uK00/11-129 cath|current|3v6vK00/11-129 cath|current|3zn7K00/11-129 cath|current|3zndK00/11-129 cath|current|3zvoK00/11-129 cath|current|4abrK00/11-129 cath|current|4aqyK00/11-129 cath|current|4b3mK00/1-119 cath|current|4b3rK00/1-119 cath|current|4b3sK00/1-119 cath|current|4b3tK00/1-119 cath|current|4b8fK00/11-129 cath|current|4b8hK00/11-129 cath|current|4btcK00/11-129 cath|current|4bybK00/11-129 cath|current|4bydK00/11-129 cath|current|4cr1K00/11-129 cath|current|4dh9K00/12-126 cath|current|4dhbK00/13-126 cath|current|4dr1K00/11-126 cath|current|4dr2K00/11-127 cath|current|4dr3K00/11-126 cath|current|4dr4K00/11-129 cath|current|4dr5K00/11-129 cath|current|4dr6K00/11-127 cath|current|4dr7K00/11-127 cath|current|4duyK00/11-126 cath|current|4duzK00/11-126 cath|current|4dv0K00/11-126 cath|current|4dv1K00/11-126 cath|current|4dv2K00/11-126 cath|current|4dv3K00/11-126 cath|current|4dv4K00/11-126 cath|current|4dv5K00/11-126 cath|current|4dv6K00/11-126 cath|current|4dv7K00/11-126 cath|current|4ej9K00/11-129 cath|current|4ejaK00/11-129 cath|current|4g5kN00/11-129 cath|current|4g5mN00/11-129 cath|current|4g5tN00/11-129 cath|current|4g5vN00/11-129 cath|current|4ji0K00/11-126 cath|current|4ji1K00/11-129 cath|current|4ji2K00/11-126 cath|current|4ji3K00/11-126 cath|current|4ji4K00/11-126 cath|current|4ji5K00/11-126 cath|current|4ji6K00/11-126 cath|current|4ji7K00/11-126 cath|current|4ji8K00/11-126 cath|current|4kwzK00/11-129 cath|current|4kx1K00/11-129 cath|current|4lf4K00/11-129 cath|current|4lf5K00/11-129 cath|current|4lf6K00/11-129 cath|current|4lf7K00/11-129 cath|current|4lf8K00/11-129 cath|current|4lf9K00/11-129 cath|current|4lfaK00/11-129 cath|current|4lfbK00/11-129 cath|current|4lfcK00/11-129 cath|current|4nvuK00/13-126 cath|current|4nvwK00/13-126 cath|current|4nvyK00/13-126 cath|current|4nw0K00/13-126 cath|current|4nxmK00/11-126 cath|current|4nxnK00/11-126 cath|current|4ox9K00/11-129 cath|current|4qcmK00/13-126 cath|current|4qcoK00/13-126 cath|current|4qcqK00/13-126 cath|current|4qcsK00/13-126 cath|current|4qcuK00/13-126 cath|current|4qcwK00/13-126 cath|current|4qcyK00/13-126 cath|current|4qd0K00/13-126 cath|current|4qjtk00/13-126 cath|current|4rb5K00/13-126 cath|current|4rb7K00/13-126 cath|current|4rb9K00/13-126 cath|current|4rbbK00/13-126 cath|current|4rbdK00/13-126 cath|current|4rbfK00/13-126 cath|current|4rbhK00/13-126 cath|current|4rbjK00/13-126 cath|current|4w2aL00/11-129 cath|current|4w2cL00/11-129 ttk003000848.1 WP_008633365.1.25090 WP_008633365.1.52262 WP_008633365.1.60518 WP_008633365.1.65589 WP_008633365.1.85415 WP_008633365.1.96068 YP_144932.1.19876 262724.TTC1302 300852.TTHA1666 2ow8l 2qnhl 2uubK gi|55981635|ref|YP_144932.1| gi|386359829|ref|YP_006058074.1| gi|46199604|ref|YP_005271.1| gi|384431846|ref|YP_005641206.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]