SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2r25A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2r25A
Domain Number 1 Region: 3-165
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 6.96e-31
Family Phosphorelay protein-like 0.0000000971
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2r25A   PDB: 2r25
Sequence length 167
Comment (A:)
Sequence
MSTIPSEIINWTILNEIISMDDDDSDFSKGLIIQFIDQAQTTFAQMQRQLDGEKNLTELD
NLGHFLKGSSAALGLQRIAWVCERIQNLGRKMEHFFPNKTELVNTLSDKSIINGINIDED
DEEIKIQVDDKDENSIYLILIAKALNQSRLEFKLARIELSKYYNTNL
Download sequence
Identical sequences A0A0L8VS41 A0A250WA04 A6ZX99 B3LHB1 B5VF46 C7GJQ4 E7KA93 E7Q1K8 G2WBT4 H0GS25 N1P5U1 Q07688
YDL235C YDL235C YDL235C YDL235C YDL235C YDL235C YDL235C YDL235C tr|A6ZX99|A6ZX99_YEAS7 SCRT_00722 YDL235C YT45 YDL235C YDL235C 4932.YDL235C cath|current|2r25A00/2-167 2r25A YDL235C 2r25_A 5kbx_A YDL235C NP_010046.1.97178 YDL235C YDL235C YDL235C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]