SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2trtA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2trtA
Domain Number 1 Region: 67-200
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 9.23e-40
Family Tetracyclin repressor-like, C-terminal domain 0.000067
Further Details:      
 
Domain Number 2 Region: 3-66
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000224
Family Tetracyclin repressor-like, N-terminal domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2trtA   PDB: 2trt
Sequence length 217
Comment (A:)
Sequence
arlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
rhhdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
engfslrdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsdd
geqaflhgleslirgfevqltallqivggdkliipfc
Download sequence
Identical sequences 2trtA 2trt_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]