SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2vanA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2vanA
Domain Number 1 Region: 63-243
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 2.11e-67
Family DNA polymerase beta-like 0.0000000313
Further Details:      
 
Domain Number 2 Region: 2-57
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 7.69e-17
Family DNA polymerase beta-like, second domain 0.0000638
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2vanA   PDB: 2van
Sequence length 245
Comment (A:)
Sequence
ddtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfekri
preemlqmqdivlnevkkldpeyiatvcgsfrrgaessgdmdvllthpnftsesskqpkl
lhrvveqlqkvrfitdtlskgetkfmgvcqlpsendeneyphrridirlqpkdqyycgvl
yftgsdifnknmrahalekgftineytirplgvtgvageplpvdseqdifdyiqwryrep
kdrse
Download sequence
Identical sequences 2vanA 2van_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]