SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2vdbA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2vdbA
Domain Number 1 Region: 195-373
Classification Level Classification E-value
Superfamily Serum albumin-like 5.27e-77
Family Serum albumin-like 0.00056
Further Details:      
 
Domain Number 2 Region: 384-571
Classification Level Classification E-value
Superfamily Serum albumin-like 5.96e-74
Family Serum albumin-like 0.00067
Further Details:      
 
Domain Number 3 Region: 1-181
Classification Level Classification E-value
Superfamily Serum albumin-like 1.08e-69
Family Serum albumin-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2vdbA   PDB: 2vdb
Sequence length 579
Comment (A:)
Sequence
evahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaencdks
lhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevdvmct
afhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpkldel
rdegkassakqrlkcaslqkfgerafkawavarlsqrfpkaefaevsklvtdltkvhtec
chgdllecaddradlakyicenqdsissklkeccekpllekshciaevendempadlpsl
aadfveskdvcknyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekccaaad
phecyakvfdefkplveepqnlikqncelfeqlgeykfqnallvrytkkvpqvstptlve
vsrnlgkvgskcckhpeakrmpcaedylsvvlnqlcvlhektpvsdrvtkccteslvnrr
pcfsalevdetyvpkefnaetftfhadictlsekerqikkqtalvelvkhkpkatkeqlk
avmddfaafvekcckaddketcfaeegkklvaasqaalg
Download sequence
Identical sequences 2vdb_A 2vdbA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]