SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2z3vA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2z3vA
Domain Number 1 Region: 5-137
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.33e-44
Family Universal stress protein-like 0.00000232
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2z3vA   PDB: 2z3v
Sequence length 137
Comment (A:)
Sequence
MFKTILLAYDGSEHARRAAEVAKAEAEAHGARLIVVHAYEPVPDYLGEPFFEEALRRRLE
RAEGVLEEARALTGVPKEDALLLEGVPAEAILQAARAEKADLIVMGTRGLGALGSLFLGS
QSQRVVAEAPCPVLLVR
Download sequence
Identical sequences Q5SJV7
gi|55980864|ref|YP_144161.1| 2z3vA ttk003001817.1 ttk003001817.2 ttk003001817.3 ttk003001817.4 cath|current|1wjgA00/2-136 cath|current|2z08A00/1-137 cath|current|2z09A00/1-137 cath|current|2z3vA00/1-137 d2z08a_ d2z09a_ d2z3va_ 300852.TTHA0895 YP_144161.1.19876 1wjg_A 2z08_A 2z09_A 2z3v_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]