SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2zgwA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2zgwA
Domain Number 1 Region: 3-177
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.96e-49
Family Biotin holoenzyme synthetase 0.0000000256
Further Details:      
 
Domain Number 2 Region: 190-233
Classification Level Classification E-value
Superfamily C-terminal domain of transcriptional repressors 0.000000000849
Family Biotin repressor (BirA) 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2zgwA   PDB: 2zgw
Sequence length 235
Comment (A:)
Sequence
mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgalnrkwespeggl
wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykaiagvlvegk
gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
lvrdnmilgvrvkilgdgsfegiaediddfgrliirldsgevkkviygdvslrfl
Download sequence
Identical sequences 2e41_A 2e41_B 2e64_A 2e64_B 2ejf_A 2ejf_B 2zgw_A 2zgw_B 2zgwA pho001000147.21 pho001000147.22 pho001000147.24 pho001000147.25

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]