SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3bonA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3bonA
Domain Number 1 Region: 3-424
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.8e-160
Family Clostridium neurotoxins, catalytic domain 0.0000000000142
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 3bonA   PDB: 3bon
Sequence length 425
Comment (A:)
Sequence
mqfvnkqfnykdpvngvdiayikipnvgqmqpvkafkihnkiwviperdtftnpeegdln
pppeakqvpvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipfwgg
stidtelkvidtncinviqpdgsyrseelnlviigpsadiiqfecksfghevlnltrngy
gstqyirfspdftfgfeeslevdtnpllgagkfatdpavtlahelihaghrlygiainpn
rvfkvntnayyemsglevsfeelrtfgghdakfidslqenefrlyyynkfkdiastlnka
ksivgttaslqymknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvkffkv
lnrktylnfdkavfkinivpkvnytiydgfnlrntnlaanfngqnteinnmnftklknft
glfef
Download sequence
Identical sequences 3bok_A 3bon_A 3boo_A cath|current|3bokA00/1-423 cath|current|3bonA00/2-423 cath|current|3booA00/1-425 3bonA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]