SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3bpdA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3bpdA
Domain Number 1 Region: 7-92
Classification Level Classification E-value
Superfamily MTH889-like 6.59e-43
Family MTH889-like 0.0000893
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 3bpdA   PDB: 3bpd
Sequence length 100
Comment (A:)
Sequence
mslkglrrlvldvlkphepktivfalklselenvdgvnihlseidqatenikitilgnnl
dyeqikgviedmggvihsvdevvagkiivesveghhhhhh
Download sequence
Identical sequences 3bpd_A 3bpd_B 3bpd_C 3bpd_D 3bpd_E 3bpd_F 3bpd_G 3bpd_H 3bpd_I 3bpd_J 3bpd_K 3bpd_L 3bpd_M 3bpd_N 3bpdA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]