SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3brxA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3brxA
Domain Number 1 Region: 8-314
Classification Level Classification E-value
Superfamily Annexin 1.46e-152
Family Annexin 0.00000000061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 3brxA   PDB: 3brx
Sequence length 317
Comment (A:)
Sequence
hhatltvpttvpsvsedceqlrkafsgwgtnegliidilghrnaeqrnlirktyaetyge
dllkaldkelsndferlvllwaldpaerdallaneatkrwtssnqvlmeiactrsanqll
harqayharykksleedvahhttgdfhklllplvssyryegeevnmtlakteakllheki
snkaysdddvirvlatrskaqinatlnhykneygndinkdlkadpkdeflallrstvkcl
vypekyfekvlrlainrrgtdegaltrvvctraevdlkviadeyqrrnsvpltraivkdt
hgdyeklllvlaghven
Download sequence
Identical sequences 3brxA 3brx_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]