SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3bt9A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3bt9A
Domain Number 1 Region: 73-186
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 8.15e-38
Family Tetracyclin repressor-like, C-terminal domain 0.000000678
Further Details:      
 
Domain Number 2 Region: 3-65
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000105
Family Tetracyclin repressor-like, N-terminal domain 0.0000882
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 3bt9A   PDB: 3bt9
Sequence length 188
Comment (A:)
Sequence
mnlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilniqesk
wqeqwkkeqikaktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnkle
nkyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsq
iflnglsk
Download sequence
Identical sequences 3bt9A 3bt9_A 3bt9_B 3bt9_D 3bt9_E 3btc_A 3btc_B 3btc_D 3btc_E

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]