SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3buxB from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3buxB
Domain Number 1 Region: 30-154
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 1.54e-112
Family N-terminal domain of cbl (N-cbl) 0.00076
Further Details:      
 
Domain Number 2 Region: 243-328
Classification Level Classification E-value
Superfamily SH2 domain 2.43e-91
Family SH2 domain 0.0087
Further Details:      
 
Domain Number 3 Region: 157-241
Classification Level Classification E-value
Superfamily EF-hand 2.17e-82
Family EF-hand modules in multidomain proteins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 3buxB   PDB: 3bux
Sequence length 329
Comment (B:)
Sequence
gsliglmkdafqphhhhhhhlsphppgtvdkkmvekcwklmdkvvrlcqnpklalknspp
yildllpdtyqhlrtilsryegkmetlgeneyfrvfmenlmkktkqtislfkegkermye
ensqprrnltklslifshmlaelkgifpsglfqgdtfritkadaaefwrkafgektivpw
ksfrqalhevhpissgleamalkstidltcndyisvfefdiftrlfqpwssllrnwnsla
vthpgymafltydevkarlqkfihkpgsyifrlsctrlgqwaigyvtadgnilqtiphnk
plfqalidgfregfylfpdgrnqnpdltg
Download sequence
Identical sequences 3buxB 1yvh_A 3bum_B 3bun_B 3buo_B 3buo_D 3buw_B 3buw_D 3bux_B 3bux_D 3ob1_B 3ob2_B 3plf_B 3plf_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]