SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3c07A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3c07A
Domain Number 1 Region: 113-256
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 9.22e-47
Family Tetracyclin repressor-like, C-terminal domain 0.0000000753
Further Details:      
 
Domain Number 2 Region: 41-99
Classification Level Classification E-value
Superfamily Homeodomain-like 2.67e-26
Family Tetracyclin repressor-like, N-terminal domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 3c07A   PDB: 3c07
Sequence length 273
Comment (A:)
Sequence
mgsshhhhhhssgrenlyfqghmpatndgpddgahlskseqtraliletamrlfqergyd
rttmraiaqeagvsvgnayyyfagkehliqgfydriaaehraavrevlaretdlearlag
vlkvwldiatpyhefavqffknaadpdsplspfspeseharveaigihravlagaktkvp
eelrdilpelmwlsqmglvlywifdrtegrersyrlaergarltargvvlarfrvlrplv
revhelftdflpgmtkvmpdpakkptrdagpqa
Download sequence
Identical sequences 3c07A 3c07_A 3c07_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]