SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3c5gA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3c5gA
Domain Number 1 Region: 150-334
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 3.16e-80
Family DNA polymerase beta-like 0.000000504
Further Details:      
 
Domain Number 2 Region: 3-87
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 7.32e-35
Family DNA polymerase beta, N-terminal domain-like 0.0000339
Further Details:      
 
Domain Number 3 Region: 90-144
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 6.31e-18
Family DNA polymerase beta-like, second domain 0.0000777
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 3c5gA   PDB: 3c5g
Sequence length 335
Comment (A:)
Sequence
maqpssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeac
sipgigkrmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsl
edirsqaslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrr
gkatcgdvdvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlp
gpgrrhrrldiivvpysefacallyftgsahfnrsmkalaktkgmslsehalstavvrnt
hgckvgpgrvlptptekdvfrllglpyrepaerdw
Download sequence
Identical sequences 3c5gA 3c5g_A 3c5g_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]