SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3cnjA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3cnjA
Domain Number 1 Region: 312-443
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.73e-57
Family GMC oxidoreductases 0.000000111
Further Details:      
 
Domain Number 2 Region: 6-308,440-498
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.97e-43
Family FAD-linked reductases, N-terminal domain 0.00000000000626
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 3cnjA   PDB: 3cnj
Sequence length 499
Comment (A:)
Sequence
ggyvpavvigtgygaavsalrlgeagvqtlmlemgqlwnqpgpdgnifcgmlnpdkrssw
fknrteaplgsflwldvvnrnidpyagvldrvnydqmsvyvgrgvgggslvnggmavepk
rsyfeeilprvdssemydryfpransmlrvnhidtkwfedtewykfarvsreqagkaglg
tvfvpnvydfgymqreaagevpksalateviygnnhgkqsldktylaaalgtgkvtiqtl
hqvktirqtkdggyaltveqkdtdgkllatkeiscrylflgagslgstellvrardtgtl
pnlnsevgagwgpngnimtaranhmwnptgahqssipalgidawdnsdssvwaeiapmpa
gletwvslylaitknpqrgtfvydaatdraklnwtrdqnapavnaakalfdrinkangti
yrydlfgtqlkafaddfcyhplggcvlgkatddygrvagyknlyvtdgslipgsvgvnpf
vtitalaernveriikqdv
Download sequence
Identical sequences 3cnjA 3cnj_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]