SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3cojA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3cojA
Domain Number 1 Region: 26-132
Classification Level Classification E-value
Superfamily BRCT domain 5.05e-28
Family BRCT domain 0.00000162
Further Details:      
 
Domain Number 2 Region: 135-233
Classification Level Classification E-value
Superfamily BRCT domain 6.62e-25
Family BRCT domain 0.00000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 3cojA   PDB: 3coj
Sequence length 235
Comment (A:)
Sequence
mgsshhhhhhssglvprgshmvnkrmsmvvsgltpeefmlvykfarkhhitltnliteet
thvvmktdaefvcertlkyflgiaggkwvvsyfwvtqsikerkmlnehdfevrgdvvngr
nhqgpkraresqdrkifrgleiccygpftnmptdqlewmvqlcgasvvkelssftlgtgv
hpivvvqpdawtedngfhaigqmceapvvtrewvldsvalyqcqeldtylipqip
Download sequence
Identical sequences 3cojA 3coj_A 3coj_B 3coj_C 3coj_D 3coj_E 3coj_F 3coj_G 3coj_X

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]