SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3d29K from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3d29K
Domain Number 1 Region: 1-204
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.7e-89
Family Proteasome subunits 0.0000000244
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 3d29K   PDB: 3d29
Sequence length 212
Comment (K:)
Sequence
tttlafrfqggiivavdsratagnwvasqtvkkvieinpfllgtmaggaadcqfwetwlg
sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
tedgwiyhgnhdvgelfwkvkeeegsfnnvig
Download sequence
Identical sequences 1g0u_K 1g0u_Y 1g65_K 1g65_Y 1jd2_K 1jd2_R 2f16_K 2f16_Y 2fak_K 2fak_Y 2gpl_K 2gpl_Y 2zcy_K 2zcy_Y 3bdm_K 3bdm_Y 3d29_K 3d29_Y 3dy3_K 3dy3_Y 3dy4_K 3dy4_Y 3e47_K 3e47_Y 3gpj_K 3gpj_Y 3gpt_K 3gpt_Y 3gpw_K 3gpw_Y 3hye_K 3hye_Y 3mg0_K 3mg0_Y 3mg4_K 3mg4_Y 3mg6_K 3mg6_Y 3mg7_K 3mg7_Y 3mg8_K 3mg8_Y 3oeu_K 3oeu_Y 3oev_K 3oev_Y 3okj_K 3okj_Y 3sdi_K 3sdi_Y 3sdk_K 3sdk_Y 3shj_K 3shj_Y 3tdd_K 3tdd_Y 3un4_K 3un4_Y 3un8_K 3un8_Y 4fzc_K 4fzc_Y 4fzg_K 4fzg_Y 4g4s_L 4gk7_K 4gk7_Y 4hnp_K 4hnp_Y 4hrc_K 4hrc_Y 4hrd_K 4hrd_Y 4inr_K 4inr_Y 4int_K 4int_Y 4inu_K 4inu_Y 4j70_K 4j70_Y 4jsq_K 4jsq_Y 4jsu_K 4jsu_Y 4jt0_K 4jt0_Y 4lqi_K 4lqi_Y 4ltc_K 4ltc_Y 4nnn_K 4nnn_Y 4nnw_K 4nnw_Y 4no1_K 4no1_Y 4no6_K 4no6_Y 4no8_K 4no8_Y 4no9_K 4no9_Y 4q1s_K 4q1s_Y 4qby_K 4qby_Y 4qlq_K 4qlq_Y 4qls_K 4qls_Y 4qlt_K 4qlt_Y 4qlu_K 4qlu_Y 4qlv_K 4qlv_Y 4qvl_K 4qvl_Y 4qw4_K 4qw4_Y 4qwx_K 4qwx_Y 4qzz_K 4qzz_Y 4r02_K 4r02_Y 4r17_K 4r17_Y 4r18_K 4r18_Y 4rur_K 4rur_Y 4y69_K 4y69_Y 4y6a_K 4y6a_Y 4y6v_K 4y6v_Y 4y6z_K 4y6z_Y 4y70_K 4y70_Y 4y74_K 4y74_Y 4y75_K 4y75_Y 4y77_K 4y77_Y 4y78_K 4y78_Y 4y7w_K 4y7w_Y 4y7x_K 4y7x_Y 4y7y_K 4y7y_Y 4y80_K 4y80_Y 4y81_K 4y81_Y 4y82_K 4y82_Y 4y84_K 4y84_Y 4y8g_K 4y8g_Y 4y8h_K 4y8h_Y 4y8i_K 4y8i_Y 4y8j_K 4y8j_Y 4y8k_K 4y8k_Y 4y8l_K 4y8l_Y 4y8m_K 4y8m_Y 4y8n_K 4y8n_Y 4y8o_K 4y8o_Y 4y8p_K 4y8p_Y 4y8q_K 4y8q_Y 4y8r_K 4y8r_Y 4y8s_K 4y8s_Y 4y8t_K 4y8t_Y 4y8u_K 4y8u_Y 4y9y_K 4y9y_Y 4y9z_K 4y9z_Y 4ya0_K 4ya0_Y 4ya1_K 4ya1_Y 4ya2_K 4ya2_Y 4ya3_K 4ya3_Y 4ya4_K 4ya4_Y 4ya5_K 4ya5_Y 4ya7_K 4ya7_Y 4ya9_K 4ya9_Y 4z1l_K 4z1l_Y 5ahj_K 5ahj_Y 5bou_K 5bou_Y 5bxl_K 5bxl_Y 5bxn_K 5bxn_Y 5cz4_K 5cz4_Y 5cz5_K 5cz5_Y 5dki_K 5dki_Y 5dkj_K 5dkj_Y 5fg7_K 5fg7_Y 5fg9_K 5fg9_Y 5fgi_K 5fgi_Y 5jhr_K 5jhr_Y 5jhs_K 5jhs_Y 5l52_K 5l52_Y 5l54_K 5l54_Y 5l55_K 5l55_Y 5lai_K 5lai_Y 5laj_K 5laj_Y 6fvt_5 6fvt_l 6fvu_5 6fvu_l 6fvv_5 6fvv_l 6fvw_5 6fvw_l 6fvx_5 6fvx_l 6fvy_5 6fvy_l 6g7f_K 6g7f_Y 6g8m_K 6g8m_Y 6g8n_K 6g8n_Y 6gop_K 6gop_Y 000086951|e3e47Y1|210.1.1.2|Y:1-212 000086952|e3d29K1|210.1.1.2|K:1-212 000086953|e2gplY1|210.1.1.2|Y:1-212 000086955|e1g0uY1|210.1.1.2|Y:1-212 000086956|e2fakK1|210.1.1.2|K:1-212 000086957|e1g0uK1|210.1.1.2|K:1-212 000086959|e2gplK1|210.1.1.2|K:1-212 000086960|e3e47K1|210.1.1.2|K:1-212 000086961|e2zcyK1|210.1.1.2|K:1-212 000086962|e2f16Y1|210.1.1.2|Y:1-212 000086964|e2fakY1|210.1.1.2|Y:1-212 000086966|e3bdmK1|210.1.1.2|K:1-212 000086967|e1jd2K1|210.1.1.2|K:1-212 000086969|e1jd2R1|210.1.1.2|R:1-212 000086970|e3bdmY1|210.1.1.2|Y:1-212 000086971|e3d29Y1|210.1.1.2|Y:1-212 000086972|e2f16K1|210.1.1.2|K:1-212 000086973|e2zcyY1|210.1.1.2|Y:1-212 000142359|e3nzjK1|210.1.1.2|K:76-287 000148342|e3un4K1|210.1.1.2|K:1-212 000150614|e3sdiK1|210.1.1.2|K:1-212 000152311|e4gk7K1|210.1.1.2|K:1-212 000152425|e4g4sL1|210.1.1.2|L:1-212 000153343|e4fzcK1|210.1.1.2|K:1-212 000181714|e3oeuK1|210.1.1.2|K:1-212 000222432|e4inrK1|210.1.1.2|K:1-212 000224775|e4j70K1|210.1.1.2|K:1-212 000351418|e3dy3K1|210.1.1.2|K:1-212 000351419|e3dy3Y1|210.1.1.2|Y:1-212 000351446|e3dy4K1|210.1.1.2|K:1-212 000351447|e3dy4Y1|210.1.1.2|Y:1-212 000364527|e3gpjK1|210.1.1.2|K:1-212 000364528|e3gpjY1|210.1.1.2|Y:1-212 000372529|e3gptK1|210.1.1.2|K:1-212 000372530|e3gptY1|210.1.1.2|Y:1-212 000372557|e3gpwK1|210.1.1.2|K:1-212 000372558|e3gpwY1|210.1.1.2|Y:1-212 000372769|e3hyeK1|210.1.1.2|K:1-212 000372770|e3hyeY1|210.1.1.2|Y:1-212 000412858|e3nzjY1|210.1.1.2|Y:76-287 000412885|e3nzwK1|210.1.1.2|K:76-287 000412886|e3nzwY1|210.1.1.2|Y:76-287 000412913|e3nzxK1|210.1.1.2|K:76-287 000412914|e3nzxY1|210.1.1.2|Y:76-287 000417819|e3mg4K1|210.1.1.2|K:1-212 000417820|e3mg4Y1|210.1.1.2|Y:1-212 000419346|e3mg0K1|210.1.1.2|K:1-212 000419347|e3mg0Y1|210.1.1.2|Y:1-212 000419374|e3mg6K1|210.1.1.2|K:1-212 000419375|e3mg6Y1|210.1.1.2|Y:1-212 000419402|e3mg7K1|210.1.1.2|K:1-212 000419403|e3mg7Y1|210.1.1.2|Y:1-212 000419430|e3mg8K1|210.1.1.2|K:1-212 000419431|e3mg8Y1|210.1.1.2|Y:1-212 000421321|e3okjK1|210.1.1.2|K:1-212 000421322|e3okjY1|210.1.1.2|Y:1-212 000424418|e3oeuY1|210.1.1.2|Y:1-212 000424445|e3oevK1|210.1.1.2|K:1-212 000424446|e3oevY1|210.1.1.2|Y:1-212 000431048|e3tddK1|210.1.1.2|K:1-212 000431049|e3tddY1|210.1.1.2|Y:1-212 000435257|e3shjK1|210.1.1.2|K:1-212 000435258|e3shjY1|210.1.1.2|Y:1-212 000969542|e4fzgK1|210.1.1.2|K:1-212 000969543|e4fzgY1|210.1.1.2|Y:1-212 000969544|e3sdiY1|210.1.1.2|Y:1-212 000969545|e4fzcY1|210.1.1.2|Y:1-212 000969546|e4intY1|210.1.1.2|Y:1-212 000969547|e4inrY1|210.1.1.2|Y:1-212 000969548|e4gk7Y1|210.1.1.2|Y:1-212 000969549|e3sdkK1|210.1.1.2|K:1-212 000969550|e3sdkY1|210.1.1.2|Y:1-212 000969551|e4inuY1|210.1.1.2|Y:1-212 000969552|e4intK1|210.1.1.2|K:1-212 000969553|e3un8Y1|210.1.1.2|Y:1-212 000969554|e3un8K1|210.1.1.2|K:1-212 000969555|e3un4Y1|210.1.1.2|Y:1-212 000969556|e4inuK1|210.1.1.2|K:1-212 000969557|e4j70Y1|210.1.1.2|Y:1-212 001014610|e4jt0Y1|210.1.1.2|Y:1-212 001014612|e4jt0K1|210.1.1.2|K:1-212 001014613|e4jsuY1|210.1.1.2|Y:1-212 001014615|e4jsqY1|210.1.1.2|Y:1-212 001014616|e4jsqK1|210.1.1.2|K:1-212 001014617|e4jsuK1|210.1.1.2|K:1-212 001125508|e4lqiK1|210.1.1.2|K:1-212 001126097|e4lqiY1|210.1.1.2|Y:1-212 001140766|e4hnpK1|210.1.1.2|K:1-212 001142472|e4hnpY1|210.1.1.2|Y:1-212 001142498|e4hrcK1|210.1.1.2|K:1-212 001142499|e4hrcY1|210.1.1.2|Y:1-212 001142526|e4hrdK1|210.1.1.2|K:1-212 001142527|e4hrdY1|210.1.1.2|Y:1-212 001144681|e4nnnK1|210.1.1.2|K:1-212 001281955|e4nnnY1|210.1.1.2|Y:1-212 001281979|e4nnwK1|210.1.1.2|K:1-212 001281980|e4nnwY1|210.1.1.2|Y:1-212 001282005|e4no1K1|210.1.1.2|K:1-212 001282006|e4no1Y1|210.1.1.2|Y:1-212 001282031|e4no6K1|210.1.1.2|K:1-212 001282032|e4no6Y1|210.1.1.2|Y:1-212 001282057|e4no8K1|210.1.1.2|K:1-212 001282058|e4no8Y1|210.1.1.2|Y:1-212 001282083|e4no9K1|210.1.1.2|K:1-212 001282084|e4no9Y1|210.1.1.2|Y:1-212 001297458|e4qbyK1|210.1.1.2|K:1-212 001297459|e4qbyY1|210.1.1.2|Y:1-212 001299664|e4ltcK1|210.1.1.2|K:1-212 001299665|e4ltcY1|210.1.1.2|Y:1-212 001316308|e4qlqY1|210.1.1.2|Y:1-212 001316332|e4qlsK1|210.1.1.2|K:1-212 001316333|e4qlsY1|210.1.1.2|Y:1-212 001316360|e4qltK1|210.1.1.2|K:1-212 001316361|e4qltY1|210.1.1.2|Y:1-212 001316388|e4qluK1|210.1.1.2|K:1-212 001316389|e4qluY1|210.1.1.2|Y:1-212 001316416|e4qlvK1|210.1.1.2|K:1-212 001316417|e4qlvY1|210.1.1.2|Y:1-212 001317119|e4q1sK1|210.1.1.2|K:1-212 001317120|e4q1sY1|210.1.1.2|Y:1-212 001318577|e4qlqK1|210.1.1.2|K:1-212 001323004|e4r02K1|210.1.1.2|K:1-212 001323005|e4r02Y1|210.1.1.2|Y:1-212 001401620|e3wxrL1|210.1.1.2|L:76-287 001401621|e3wxrZ1|210.1.1.2|Z:76-287 001423645|e4rurK1|210.1.1.2|K:1-212 001423646|e4rurY1|210.1.1.2|Y:1-212 001496550|e4qvlK1|210.1.1.2|K:1-212 001496551|e4qvlY1|210.1.1.2|Y:1-212 001496858|e4qw4K1|210.1.1.2|K:1-212 001496859|e4qw4Y1|210.1.1.2|Y:1-212 001497222|e4qwxK1|210.1.1.2|K:1-212 001497223|e4qwxY1|210.1.1.2|Y:1-212 001497558|e4qzzK1|210.1.1.2|K:1-212 001497559|e4qzzY1|210.1.1.2|Y:1-212 001498435|e5ahjK1|210.1.1.2|K:1-212 001500711|e5ahjY1|210.1.1.2|Y:1-212 001557181|e4z1lK1|210.1.1.2|K:1-212 001557182|e4z1lY1|210.1.1.2|Y:1-212 001560943|e4y69K1|210.1.1.2|K:1-212 001560944|e4y69Y1|210.1.1.2|Y:1-212 001560971|e4y6aK1|210.1.1.2|K:1-212 001560972|e4y6aY1|210.1.1.2|Y:1-212 001560999|e4y6vK1|210.1.1.2|K:1-212 001561000|e4y6vY1|210.1.1.2|Y:1-212 001561027|e4y6zK1|210.1.1.2|K:1-212 001561028|e4y6zY1|210.1.1.2|Y:1-212 001561055|e4y70K1|210.1.1.2|K:1-212 001561056|e4y70Y1|210.1.1.2|Y:1-212 001561083|e4y74K1|210.1.1.2|K:1-212 001561084|e4y74Y1|210.1.1.2|Y:1-212 001561111|e4y75K1|210.1.1.2|K:1-212 001561112|e4y75Y1|210.1.1.2|Y:1-212 001561139|e4y77K1|210.1.1.2|K:1-212 001561140|e4y77Y1|210.1.1.2|Y:1-212 001561167|e4y78K1|210.1.1.2|K:1-212 001561168|e4y78Y1|210.1.1.2|Y:1-212 001561195|e4y7wK1|210.1.1.2|K:1-212 001561196|e4y7wY1|210.1.1.2|Y:1-212 001561223|e4y7xK1|210.1.1.2|K:1-212 001561224|e4y7xY1|210.1.1.2|Y:1-212 001561251|e4y7yK1|210.1.1.2|K:1-212 001561252|e4y7yY1|210.1.1.2|Y:1-212 001561279|e4y80K1|210.1.1.2|K:1-212 001561280|e4y80Y1|210.1.1.2|Y:1-212 001561307|e4y81K1|210.1.1.2|K:1-212 001561308|e4y81Y1|210.1.1.2|Y:1-212 001561335|e4y82K1|210.1.1.2|K:1-212 001561336|e4y82Y1|210.1.1.2|Y:1-212 001561363|e4y84K1|210.1.1.2|K:1-212 001561364|e4y84Y1|210.1.1.2|Y:1-212 001561391|e4y8gK1|210.1.1.2|K:1-212 001561392|e4y8gY1|210.1.1.2|Y:1-212 001561419|e4y8hK1|210.1.1.2|K:1-212 001561420|e4y8hY1|210.1.1.2|Y:1-212 001561447|e4y8iK1|210.1.1.2|K:1-212 001561448|e4y8iY1|210.1.1.2|Y:1-212 001561475|e4y8jK1|210.1.1.2|K:1-212 001561476|e4y8jY1|210.1.1.2|Y:1-212 001561503|e4y8kK1|210.1.1.2|K:1-212 001561504|e4y8kY1|210.1.1.2|Y:1-212 001561531|e4y8lK1|210.1.1.2|K:1-212 001561532|e4y8lY1|210.1.1.2|Y:1-212 001561559|e4y8mK1|210.1.1.2|K:1-212 001561560|e4y8mY1|210.1.1.2|Y:1-212 001561587|e4y8nK1|210.1.1.2|K:1-212 001561588|e4y8nY1|210.1.1.2|Y:1-212 001561615|e4y8oK1|210.1.1.2|K:1-212 001561616|e4y8oY1|210.1.1.2|Y:1-212 001561643|e4y8pK1|210.1.1.2|K:1-212 001561644|e4y8pY1|210.1.1.2|Y:1-212 001561671|e4y8qK1|210.1.1.2|K:1-212 001561672|e4y8qY1|210.1.1.2|Y:1-212 001561699|e4y8rK1|210.1.1.2|K:1-212 001561700|e4y8rY1|210.1.1.2|Y:1-212 001561727|e4y8sK1|210.1.1.2|K:1-212 001561728|e4y8sY1|210.1.1.2|Y:1-212 001561755|e4y8tK1|210.1.1.2|K:1-212 001561756|e4y8tY1|210.1.1.2|Y:1-212 001561783|e4y8uK1|210.1.1.2|K:1-212 001561784|e4y8uY1|210.1.1.2|Y:1-212 001561811|e4y9yK1|210.1.1.2|K:1-212 001561812|e4y9yY1|210.1.1.2|Y:1-212 001561839|e4y9zK1|210.1.1.2|K:1-212 001561840|e4y9zY1|210.1.1.2|Y:1-212 001561867|e4ya0K1|210.1.1.2|K:1-212 001561868|e4ya0Y1|210.1.1.2|Y:1-212 001561895|e4ya1K1|210.1.1.2|K:1-212 001561896|e4ya1Y1|210.1.1.2|Y:1-212 001561923|e4ya2K1|210.1.1.2|K:1-212 001561924|e4ya2Y1|210.1.1.2|Y:1-212 001561951|e4ya3K1|210.1.1.2|K:1-212 001561952|e4ya3Y1|210.1.1.2|Y:1-212 001561979|e4ya4K1|210.1.1.2|K:1-212 001561980|e4ya4Y1|210.1.1.2|Y:1-212 001562007|e4ya5K1|210.1.1.2|K:1-212 001562008|e4ya5Y1|210.1.1.2|Y:1-212 001562035|e4ya7K1|210.1.1.2|K:1-212 001562036|e4ya7Y1|210.1.1.2|Y:1-212 001562063|e4ya9K1|210.1.1.2|K:1-212 001562064|e4ya9Y1|210.1.1.2|Y:1-212 001680393|e5bouK1|210.1.1.2|K:1-212 001680394|e5bouY1|210.1.1.2|Y:1-212 001698381|e5dkiK1|210.1.1.2|K:1-212 001698382|e5dkiY1|210.1.1.2|Y:1-212 001698409|e5dkjK1|210.1.1.2|K:1-212 001698410|e5dkjY1|210.1.1.2|Y:1-212 001720369|e4x6zL1|210.1.1.2|L:76-287 001720370|e4x6zZ1|210.1.1.2|Z:76-287 001790457|e5cz4K1|210.1.1.2|K:1-212 001790458|e5cz4Y1|210.1.1.2|Y:1-212 001790485|e5cz5K1|210.1.1.2|K:1-212 001790486|e5cz5Y1|210.1.1.2|Y:1-212 001790941|e5fg7K1|210.1.1.2|K:1-212 001790942|e5fg7Y1|210.1.1.2|Y:1-212 001790969|e5fg9K1|210.1.1.2|K:1-212 001790970|e5fg9Y1|210.1.1.2|Y:1-212 001791165|e5fgiK1|210.1.1.2|K:1-212 001791166|e5fgiY1|210.1.1.2|Y:1-212 001840040|e4zzgL1|210.1.1.2|L:76-287 001840041|e4zzgZ1|210.1.1.2|Z:76-287 001841799|e5bxlK1|210.1.1.2|K:1-212 001841800|e5bxlY1|210.1.1.2|Y:1-212 001841827|e5bxnK1|210.1.1.2|K:1-212 001841828|e5bxnY1|210.1.1.2|Y:1-212 001842372|e3jco71|210.1.1.2|7:76-287 001842373|e3jcol1|210.1.1.2|l:76-287 001842435|e3jcp71|210.1.1.2|7:76-287 001842436|e3jcpl1|210.1.1.2|l:76-287 001869495|e5jhrK1|210.1.1.2|K:1-212 001869496|e5jhrY1|210.1.1.2|Y:1-212 001869522|e5jhsK1|210.1.1.2|K:1-212 001869523|e5jhsY1|210.1.1.2|Y:1-212 001917315|e5l52K1|210.1.1.2|K:1-212 001917316|e5l52Y1|210.1.1.2|Y:1-212 001917343|e5l54K1|210.1.1.2|K:1-212 001917344|e5l54Y1|210.1.1.2|Y:1-212 001917371|e5l55K1|210.1.1.2|K:1-212 001917372|e5l55Y1|210.1.1.2|Y:1-212 002036868|e5mp9l1|210.1.1.2|l:76-287 002036869|e5mp951|210.1.1.2|5:76-287 002036905|e5mpal1|210.1.1.2|l:76-287 002036906|e5mpa51|210.1.1.2|5:76-287 002037256|e5mpbl1|210.1.1.2|l:76-287 002037257|e5mpb51|210.1.1.2|5:76-287 002037319|e5mpcl1|210.1.1.2|l:76-287 002037320|e5mpc51|210.1.1.2|5:76-287 002047324|e5wvi51|210.1.1.2|5:76-287 002047325|e5wvif1|210.1.1.2|f:76-287 002047344|e5wvk51|210.1.1.2|5:76-287 002047345|e5wvkf1|210.1.1.2|f:76-287 002067855|e5lajK1|210.1.1.2|K:1-212 002067856|e5lajY1|210.1.1.2|Y:1-212 002097832|e5nifL1|210.1.1.2|L:76-287 002097833|e5nifZ1|210.1.1.2|Z:76-287 cath|current|1g0uK00/1-211 cath|current|1g0uY00/1-211 cath|current|1jd2K00/1-211 cath|current|1jd2R00/1-211 cath|current|2f16K00/1-211 cath|current|2f16Y00/1-211 cath|current|2fakK00/1-211 cath|current|2fakY00/1-211 cath|current|2fnyK00/1-211 cath|current|2fnyY00/1-211 cath|current|2gplK00/1-211 cath|current|2gplY00/1-211 cath|current|2zcyK00/1-211 cath|current|2zcyY00/1-211 cath|current|3bdmK00/1-211 cath|current|3bdmY00/1-211 cath|current|3d29K00/1-211 cath|current|3d29Y00/1-211 cath|current|3dy3K00/1-211 cath|current|3dy3Y00/1-211 cath|current|3dy4K00/1-211 cath|current|3dy4Y00/1-211 cath|current|3e47K00/1-211 cath|current|3e47Y00/1-211 cath|current|3gpjK00/1-211 cath|current|3gpjY00/1-211 cath|current|3gptK00/1-211 cath|current|3gptY00/1-211 cath|current|3gpwK00/1-211 cath|current|3gpwY00/1-211 cath|current|3hyeK00/1-211 cath|current|3hyeY00/1-211 cath|current|3mg0K00/1-211 cath|current|3mg0Y00/1-211 cath|current|3mg4K00/1-211 cath|current|3mg4Y00/1-211 cath|current|3mg6K00/1-211 cath|current|3mg6Y00/1-211 cath|current|3mg7K00/1-211 cath|current|3mg7Y00/1-211 cath|current|3mg8K00/1-211 cath|current|3mg8Y00/1-211 cath|current|3nzjK00/1-211 cath|current|3nzjY00/1-211 cath|current|3nzwK00/1-211 cath|current|3nzwY00/1-211 cath|current|3nzxK00/1-211 cath|current|3nzxY00/1-211 cath|current|3oeuK00/1-211 cath|current|3oeuY00/1-211 cath|current|3oevK00/1-211 cath|current|3oevY00/1-211 cath|current|3okjK00/1-211 cath|current|3okjY00/1-211 cath|current|3sdiK00/1-211 cath|current|3sdiY00/1-211 cath|current|3sdkK00/1-211 cath|current|3sdkY00/1-211 cath|current|3shjK00/1-211 cath|current|3shjY00/1-211 cath|current|3tddK00/1-211 cath|current|3tddY00/1-211 cath|current|3un4K00/1-212 cath|current|3un4Y00/1-212 cath|current|3un8K00/1-212 cath|current|3un8Y00/1-212 cath|current|3wxrL00/1-212 cath|current|3wxrZ00/1-212 cath|current|4fzcK00/1-212 cath|current|4fzcY00/1-212 cath|current|4fzgK00/1-212 cath|current|4fzgY00/1-212 cath|current|4g4sL00/1-212 cath|current|4gk7K00/1-212 cath|current|4gk7Y00/1-212 cath|current|4hnpK00/1-212 cath|current|4hnpY00/1-212 cath|current|4hrcK00/1-212 cath|current|4hrcY00/1-212 cath|current|4hrdK00/1-212 cath|current|4hrdY00/1-212 cath|current|4inrK00/1-212 cath|current|4inrY00/1-212 cath|current|4intK00/1-212 cath|current|4intY00/1-212 cath|current|4inuK00/1-212 cath|current|4inuY00/1-212 cath|current|4j70K00/1-212 cath|current|4j70Y00/1-212 cath|current|4jsqK00/1-212 cath|current|4jsqY00/1-212 cath|current|4jsuK00/1-212 cath|current|4jsuY00/1-212 cath|current|4jt0K00/1-212 cath|current|4jt0Y00/1-212 cath|current|4lqiK00/1-211 cath|current|4lqiY00/1-211 cath|current|4ltcK00/1-212 cath|current|4ltcY00/1-212 cath|current|4nnnK00/1-212 cath|current|4nnnY00/1-212 cath|current|4nnwK00/1-212 cath|current|4nnwY00/1-212 cath|current|4no1K00/1-212 cath|current|4no1Y00/1-212 cath|current|4no6K00/1-212 cath|current|4no6Y00/1-212 cath|current|4no8K00/1-212 cath|current|4no8Y00/1-212 cath|current|4no9K00/1-212 cath|current|4no9Y00/1-212 cath|current|4q1sK00/1-212 cath|current|4q1sY00/1-212 cath|current|4qbyK00/1-212 cath|current|4qbyY00/1-212 cath|current|4qlqK00/1-212 cath|current|4qlqY00/1-212 cath|current|4qlsK00/1-212 cath|current|4qlsY00/1-212 cath|current|4qltK00/1-212 cath|current|4qltY00/1-212 cath|current|4qluK00/1-212 cath|current|4qluY00/1-212 cath|current|4qlvK00/1-212 cath|current|4qlvY00/1-212 cath|current|4r02K00/1-212 cath|current|4r02Y00/1-212 cath|current|4r17K00/2-212 cath|current|4r17Y00/2-212 cath|current|4r18K00/2-212 cath|current|4r18Y00/2-212 cath|current|4rurK00/1-212 cath|current|4rurY00/1-212 d1g0uk_ d1g0uy_ d1g65k_ d1g65y_ d1jd2k_ d1jd2r_ d2f16k_ d2f16y_ d2fakk_ d2faky_ d2fnyk_ d2fnyy_ d2gplk_ d2gply_ d2zcyk_ d2zcyy_ d3bdmk_ d3bdmy_ d3d29k_ d3d29y_ d3dy3k_ d3dy3y_ d3dy4k_ d3dy4y_ d3e47k_ d3e47y_ d3gpjk_ d3gpjy_ d3gptk_ d3gpty_ d3gpwk_ d3gpwy_ d3hyek_ d3hyey_ d3mg0k_ d3mg0y_ d3mg4k_ d3mg4y_ d3mg6k_ d3mg6y_ d3mg7k_ d3mg7y_ d3mg8k_ d3mg8y_ d3nzjk_ d3nzjy_ d3nzwk_ d3nzwy_ d3nzxk_ d3nzxy_ d3oeuk_ d3oeuy_ d3oevk_ d3oevy_ d3okjk_ d3okjy_ d3sdik_ d3sdiy_ d3sdkk_ d3sdky_ d3shjk_ d3shjy_ d3tddk_ d3tddy_ d3un8k_ d3un8y_ d3wxrl_ d3wxrz_ d4fzck_ d4fzcy_ d4fzgk_ d4fzgy_ d4g4sl_ d4hnpk_ d4hnpy_ d4hrck_ d4hrcy_ d4hrdk_ d4hrdy_ d4inrk_ d4inry_ d4intk_ d4inty_ d4inuk_ d4inuy_ d4j70k_ d4j70y_ d4jsqk_ d4jsqy_ d4jsuk_ d4jsuy_ d4jt0k_ d4jt0y_ d4lqik_ d4lqiy_ d4ltck_ d4ltcy_ d4nnnk_ d4nnny_ d4nnwk_ d4nnwy_ d4no1k_ d4no1y_ d4no6k_ d4no6y_ d4no8k_ d4no8y_ d4no9k_ d4no9y_ d4q1sk_ d4q1sy_ d4qlqk_ d4qlqy_ d4qlsk_ d4qlsy_ d4qltk_ d4qlty_ d4qluk_ d4qluy_ d4qlvk_ d4qlvy_ d4qvlk_ d4qvly_ d4qw4k_ d4qw4y_ d4qwxk_ d4qwxy_ d4qzzk_ d4qzzy_ d4r02k_ d4r02y_ d4rurk_ d4rury_ d4y8mk_ d4y8my_ d4y8rk_ d4y8ry_ d4y9yk_ d4y9yy_ d4ya1k_ d4ya1y_ d4ya4k_ d4ya4y_ d4z1lk_ d4z1ly_ d5ahjk_ d5ahjy_ d5bouk_ d5bouy_ d5bxlk_ d5bxly_ d5bxnk_ d5bxny_ d5cz4k_ d5cz4y_ d5cz5k_ d5cz5y_ d5dkik_ d5dkiy_ d5dkjk_ d5dkjy_ d5fg7k_ d5fg7y_ d5fg9k_ d5fg9y_ d5fgik_ d5fgiy_ d5jhrk_ d5jhry_ d5jhsk_ d5jhsy_ d5l52k_ d5l52y_ d5l54k_ d5l54y_ d5l55k_ d5l55y_ d5lajk_ d5lajy_ 3d29K

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]