SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3daaA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3daaA
Domain Number 1 Region: 6-273
Classification Level Classification E-value
Superfamily D-aminoacid aminotransferase-like PLP-dependent enzymes 1.58e-112
Family D-aminoacid aminotransferase-like PLP-dependent enzymes 0.00000000942
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 3daaA   PDB: 3daa   SUPERFAMILY: 3daaA
Sequence length 277
Comment (A:)
Sequence
gytlwndqivkdeevkidkedrgyqfgdgvyevvkvyngemftvnehidrlyasaekiri
tipytkdkfhqllhelveknelntghiyfqvtrgtsprahqfpentvkpviigytkenpr
plenlekgvkatfvedirwlrcdikslnllgavlakqeahekgcyeailhrnntvtegss
snvfgikdgilythpannmilkgitrdvviacaneinmpvkeipftthealkmdelfvts
ttseitpvieidgklirdgkvgewtrklqkqfetkip
Download sequence
Identical sequences 3daa_A 3daa_B 4daa_A 4daa_B 3daaA d1daaa_ d1daab_ d2daaa_ d2daab_ d3daaa_ d3daab_ d4daaa_ d4daab_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]