SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4ubpC from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4ubpC
Domain Number 1 Region: 132-435,484-570
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 2.33e-192
Family alpha-subunit of urease, catalytic domain 0.000000000000758
Further Details:      
 
Domain Number 2 Region: 2-180
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 6.41e-65
Family alpha-Subunit of urease 0.000000631
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 4ubpC   PDB: 4ubp
Sequence length 570
Comment (C:)
Sequence
mkinrqqyaesygptvgdevrladtdlwievekdyttygdevnfgggkvlregmgengty
trtenvldllltnalildytgiykadigvkdgyivgigkggnpdimdgvtpnmivgtate
viaaegkivtaggidthvhfinpdqvdvalangittlfgggtgpaegskattvtpgpwni
ekmlksteglpinvgilgkghgssiapimeqidagaaglkihedwgatpasidrsltvad
eadvqvaihsdtlneagfledtlraingrvihsfhvegaggghapdimamaghpnvlpss
tnptrpftvntidehldmlmvchhlkqnipedvafadsrirpetiaaedilhdlgiismm
stdalamgragemvlrtwqtadkmkkqrgplaeekngsdnfrlkryvskytinpaiaqgi
ahevgsieegkfadlvlwepkffgvkadrvikggiiayaqigdpsasiptpqpvmgrrmy
gtvgdlihdtnitfmskssiqqgvpaklglkrrigtvkncrnigkkdmkwndvttdidin
petyevkvdgevltcepvkelpmaqryflf
Download sequence
Identical sequences 4ubpC 1s3t_C 1ubp_C 2ubp_C 3ubp_C 4ac7_C 4ceu_C 4cex_C 4ubp_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]