SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5daaA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5daaA
Domain Number 1 Region: 6-273
Classification Level Classification E-value
Superfamily D-aminoacid aminotransferase-like PLP-dependent enzymes 9.23e-109
Family D-aminoacid aminotransferase-like PLP-dependent enzymes 0.00000000942
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 5daaA   PDB: 5daa   SUPERFAMILY: 5daaA
Sequence length 277
Comment (A:)
Sequence
gytlwndqivkdeevkidkedrgyqfgdgvyevvkvyngemftvnehidrlyasaekiri
tipytkdkfhqllhelveknelntghiyfqvtrgtsprahqfpentvkpviigytkenpr
plenlekgvkatfvedirwlrcdikslnllgavlakqeahekgcyeailhrnntvtkgss
snvfgikdgilythpannmilkgitrdvviacaneinmpvkeipftthealkmdelfvts
ttseitpvieidgklirdgkvgewtrklqkqfetkip
Download sequence
Identical sequences 5daa_A 5daa_B 5daaA d5daaa_ d5daab_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]