SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7fd1A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7fd1A
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 3.13e-25
Family 7-Fe ferredoxin 0.00000354
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 7fd1A   PDB: 7fd1   SUPERFAMILY: 7fd1A
Sequence length 106
Comment (A:)
Sequence
afvvtdncikckytdcvevcpvdcfyegpnflvihpdecidcalcepecpaqaifsedev
pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler
Download sequence
Identical sequences 1axq_A 1fda_A 1fdb_A 1fer_A 5fd1_A 6fd1_A 6fdr_A 7fd1_A 7fdr_A 000005471|e7fd1A1|205.1.1.3|A:1-106 000066968|e7fdrA1|205.1.1.3|A:1-106 000066971|e1ferA1|205.1.1.3|A:1-106 000066975|e1fdaA1|205.1.1.3|A:1-106 000066983|e6fd1A1|205.1.1.3|A:1-106 000066984|e1fdbA1|205.1.1.3|A:1-106 000066994|e1axqA1|205.1.1.3|A:1-106 000066999|e6fdrA1|205.1.1.3|A:1-106 000067003|e5fd1A1|205.1.1.3|A:1-106 cath|current|1axqA00/1-106 cath|current|1fdaA00/1-106 cath|current|1fdbA00/1-106 cath|current|1fdc000/1-106 cath|current|1ferA00/1-106 cath|current|5fd1A00/1-106 cath|current|6fd1A00/1-106 cath|current|6fdrA00/1-106 cath|current|7fd1A00/1-106 cath|current|7fdrA00/1-106 d1axqa_ d1fdaa_ d1fdba_ d1fera_ d5fd1a_ d6fd1a_ d6fdra_ d7fd1a_ d7fdra_ 7fd1A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]