SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9antA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9antA
Domain Number 1 Region: 3-60
Classification Level Classification E-value
Superfamily Homeodomain-like 1.55e-37
Family Homeodomain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 9antA   PDB: 9ant   SUPERFAMILY: 9antA
Sequence length 62
Comment (A:)
Sequence
merkrgrqtytryqtlelekefhfnryltrrrrieiahalslterqikiwfqnrrmkwkk
en
Download sequence
Identical sequences 9antA cath|current|9antA00/5-60 cath|current|9antB00/5-60 9ant_A 9ant_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]