SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1avyA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1avyA
Domain Number 1 Region: 7-74
Classification Level Classification E-value
Superfamily Fibritin 4.9e-29
Family Fibritin 0.0000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1avyA   PDB: 1avy   SUPERFAMILY: 1avyA
Sequence length 74
Comment (A:)
Sequence
veesgltnkikaietdiasvrqevntakgnisslqgdvqalqeagyipeaprdgqayvrk
dgewvllstflspa
Download sequence
Identical sequences cath|current|1avyA00/419-486 cath|current|1avyC00/418-485 1avy_A 1avy_B 1avy_C 1avyA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]