SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1c9bB from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1c9bB
Domain Number 1 Region: 92-176
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 7.69e-55
Family TATA-box binding protein (TBP), C-terminal domain 0.02
Further Details:      
 
Domain Number 2 Region: 7-86
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 4.9e-54
Family TATA-box binding protein (TBP), C-terminal domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1c9bB   PDB: 1c9b
Sequence length 180
Comment (B:)
Sequence
gsgivpqlqnivstvnlgckldlktialrarnaeynpkrfaavimrireprttalifssg
kmvctgakseeqsrlaarkyarvvqklgfpakfldfkiqnmvgscdvkfpirleglvlth
qqfssyepelfpgliyrmikprivllifvsgkvvltgakvraeiyeafeniypilkgfrk
Download sequence
Identical sequences 1c9bB 1c9b_B 1c9b_F 1c9b_J 1c9b_N 1c9b_R

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]